PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01003592G0180
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family GRF
Protein Properties Length: 413aa    MW: 46690.5 Da    PI: 9.6811
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01003592G0180genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC75.36.4e-24137181145
              WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                      d+epgrCrRtDGKkWRCs+++++++k+CErH++r+r+rsrk++e+
  PH01003592G0180 137 DPEPGRCRRTDGKKWRCSKEAMADHKYCERHINRNRHRSRKPVEN 181
                      79****************************************997 PP

2QLQ56.48.8e-2078112236
              QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36 
                      +FT++Q+++L++Q+l+yKyL+a++P+P+ Ll  i+
  PH01003592G0180  78 PFTPSQWMELEHQALIYKYLNAKAPIPSSLLISIS 112
                      9******************************9886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009519.2E-1177113IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166621.27778113IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088802.4E-1478111IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.803137181IPR014977WRC domain
PfamPF088793.5E-20138180IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 413 aa     Download sequence    Send to blast
MELGEVLDLQ GLTMPPPKES DLNLMKRSNI TQAASYPSPF LDEQKMLRFS KAARTLPSGM  60
DFGRPNEHMF LLSRTKRPFT PSQWMELEHQ ALIYKYLNAK APIPSSLLIS ISQSFRSSSN  120
RMSWRPLYQG FANADSDPEP GRCRRTDGKK WRCSKEAMAD HKYCERHINR NRHRSRKPVE  180
NQTRKTAKET PAAGSLSSPV SQGSFKKAKV NELKPGSVNY WTDSLNRTML SKEKANKHAE  240
DNNAPLLNST NRQPTLSLIS QPKQQNKPDK FSPTVDSESI SSNTILKPWE SSNQQSNKNI  300
SCTQLHDREC LQSVLQNFSL PKNEKIESQK NKASNPIQVS STFYSSPDGP RISCLTSNMT  360
QVHDDCISSS WEMPQGGPLG EILTNSKNTE DFTKKCESRS YGWLLNLEDH EM*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006650403.10.0PREDICTED: growth-regulating factor 9
SwissprotQ9FRG80.0GRF9_ORYSJ; Growth-regulating factor 9
TrEMBLJ3LRI90.0J3LRI9_ORYBR; Uncharacterized protein
STRINGOB03G36650.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP131242529
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22840.12e-38growth-regulating factor 1